PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10019633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 310aa    MW: 34373.3 Da    PI: 6.3348
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10019633genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-42121121101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp eqp+kfa vh++FGasn+ k+l++lp ++reda++sl+yeA+ar+rdPvyG+vg i++lqq+l++l+ +l++++
  Lus10019633  12 PCAACKFLRRKCTSECVFAPYFPPEQPSKFATVHRVFGASNIAKILNELPASDREDAVTSLFYEADARLRDPVYGCVGYISHLQQRLKELHFNLESAR 109
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  ++l
  Lus10019633 110 HQL 112
                  985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.25611112IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4212109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MAMASPVSHN SPCAACKFLR RKCTSECVFA PYFPPEQPSK FATVHRVFGA SNIAKILNEL  60
PASDREDAVT SLFYEADARL RDPVYGCVGY ISHLQQRLKE LHFNLESARH QLSCYVSPPP  120
VPPVTSNFNP NPTPFPQQMP MMTSVPGVPG GQIINNNNLQ QQPQQQQQQF HNLMQVQELQ  180
QQMGPGSSMA QQEMIMRAYD QQLQQIQQEA ICRGGDNGSV TLAGYNQIGN HQHHQHQHHH  240
KSVSPISLGI GRDIHDGSST VAPPAVGGIN HDDDDDDGRF QLFLQQPPQQ ERAEEEEETG  300
RSRSNLIGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079177.17e-58PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012079178.17e-58PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-55LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS922e-61A0A0B0PS92_G
STRINGGSMUA_Achr6P04670_0017e-55(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-54ASYMMETRIC LEAVES 2-like 1